PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13066
Common NameKK1_013470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 184aa    MW: 21141.9 Da    PI: 9.0033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13066genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.86.9e-201663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd++l+++++ +G ++Wkt+a + g++R++k+c++rw++yl
    C.cajan_13066 16 RGAWTSEEDQKLAQCIEIHGAKRWKTVAIKSGLNRCGKSCRLRWLNYL 63
                     89********************************************97 PP

2Myb_DNA-binding543.8e-1769113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + eE++l+++++k+lG++ W++Ia++++ gRt++++k++w++ 
    C.cajan_13066  69 RGNISVEEEDLIIRLHKLLGNR-WSLIAKRLP-GRTDNEIKNYWNTC 113
                      78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3311163IPR017930Myb domain
SuperFamilySSF466899.17E-3015110IPR009057Homeodomain-like
SMARTSM007171.8E-151565IPR001005SANT/Myb domain
PfamPF002491.5E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231770IPR009057Homeodomain-like
CDDcd001671.07E-101863No hitNo description
PROSITE profilePS5129425.51564118IPR017930Myb domain
SMARTSM007179.4E-1568116IPR001005SANT/Myb domain
PfamPF002491.0E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2571118IPR009057Homeodomain-like
CDDcd001672.20E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MATHKNDETA KKTNNRGAWT SEEDQKLAQC IEIHGAKRWK TVAIKSGLNR CGKSCRLRWL  60
NYLRPNIKRG NISVEEEDLI IRLHKLLGNR WSLIAKRLPG RTDNEIKNYW NTCLCKKVNH  120
TKVKAETSMA QPTHSTQNNT EERAVVENKE ANDGSGDSEV NFDVNEFFNF SMEGLYALDW  180
MISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-301511826128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-65AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516658.11e-117PREDICTED: transcription factor MYB32-like
SwissprotP102905e-52MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A151TJB31e-136A0A151TJB3_CAJCA; Anthocyanin regulatory C1 protein
STRINGGLYMA01G41610.21e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.11e-50myb domain protein 23